PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4BS_B7B7EFF37.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YA
Protein Properties Length: 296aa    MW: 32227.9 Da    PI: 7.7427
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4BS_B7B7EFF37.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA102.34.5e-32205261158
              CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                            +ep+YVNaKQy++Il+RRq+Rak+e e+k  +k+rkpylheSRh+hA+rR+Rg+gGrF
  Traes_4BS_B7B7EFF37.1 205 EEPVYVNAKQYHGILRRRQSRAKAELERKA-IKARKPYLHESRHQHAMRRARGTGGRF 261
                            69***************************9.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005217.2E-36203264IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.039204264IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.7E-27206261IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006168.4E-25207229IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860209229IPR018362CCAAT-binding factor, conserved site
PRINTSPR006168.4E-25238261IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010262Biological Processsomatic embryogenesis
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0055046Biological Processmicrogametogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MDCNPVAQYD YCAVNLTGGY FEKSRWLEEA VMSGMGSRPG ESNLVEPRGL PSGMPMQPWW  60
TGTGFGAVSP AVVAPASGAG ISLSSNPLGG GAAKGATTQG KKTVDDDDAR AESSDDDSPR  120
SGEPKDGSFD EEKQHATSRM PALASDYLPP YSQLELNQPI ASAAYPYPDA YYTGMVGPYG  180
VHAVTHFQLP GLTHPRMPLP LEVSEEPVYV NAKQYHGILR RRQSRAKAEL ERKAIKARKP  240
YLHESRHQHA MRRARGTGGR FLNTKKDENG GRTEASKGEQ SSEYLRVPPD LHLRQA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A4e-20205269266NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3541160.0AK354116.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1005C04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003560983.11e-151PREDICTED: nuclear transcription factor Y subunit A-4-like
RefseqXP_010231280.11e-151PREDICTED: nuclear transcription factor Y subunit A-4-like
RefseqXP_014752975.11e-151PREDICTED: nuclear transcription factor Y subunit A-4-like
RefseqXP_014752976.11e-151PREDICTED: nuclear transcription factor Y subunit A-4-like
SwissprotQ945M91e-42NFYA9_ARATH; Nuclear transcription factor Y subunit A-9
TrEMBLW5ED120.0W5ED12_WHEAT; Uncharacterized protein
STRINGBRADI1G11800.11e-150(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82053649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20910.12e-37nuclear factor Y, subunit A9
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]